ORC4L Antibody - middle region (ARP57782_P050)

Data Sheet
 
Product Number ARP57782_P050
Product Page www.avivasysbio.com/orc4l-antibody-middle-region-arp57782-p050.html
Name ORC4L Antibody - middle region (ARP57782_P050)
Protein Size (# AA) 436 amino acids
Molecular Weight 50kDa
Subunit 4
NCBI Gene Id 5000
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Origin recognition complex, subunit 4
Alias Symbols ORC4L, ORC4P
Peptide Sequence Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)
Description of Target The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves
Protein Interactions RRM2B; TCF4; MCM3; MTUS1; MCM10; FBXL8; FBXO6; FBXO25; FBXL5; ORC3; ORC6; UBC; ORC5; ORC2; MLH1; MCM7; KPNA1; CTBP1; CDKN2A; CCND1; APP; XRCC5; XRCC6; CCL2; tat; MCM2; ORC1; MCM6; MCM4; DBF4; RPA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ORC4 (ARP57782_P050) antibody
Blocking Peptide For anti-ORC4 (ARP57782_P050) antibody is Catalog # AAP57782 (Previous Catalog # AAPP38839)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ORC4L
Uniprot ID O43929
Protein Name Origin recognition complex subunit 4
Protein Accession # NP_859525
Purification Affinity Purified
Nucleotide Accession # NM_181741
Tested Species Reactivity Human
Gene Symbol ORC4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human Liver
WB Suggested Anti-ORC4L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com