| Product Number |
ARP57768_P050 |
| Product Page |
www.avivasysbio.com/mrpl47-antibody-middle-region-arp57768-p050.html |
| Name |
MRPL47 Antibody - middle region (ARP57768_P050) |
| Protein Size (# AA) |
140 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
57129 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mitochondrial ribosomal protein L47 |
| Alias Symbols |
NCM1, L47mt, CGI-204, MRP-L47 |
| Peptide Sequence |
Synthetic peptide located within the following region: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,Z. (2003) Genomics 81 (5), 468-480 |
| Description of Target |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot |
| Protein Interactions |
GRSF1; UBC; MRPL43; MRPL45; CLPTM1L; MRPL44; TSR1; MRPL50; LAMTOR3; ACTA2; Ybx1; ICT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MRPL47 (ARP57768_P050) antibody |
| Blocking Peptide |
For anti-MRPL47 (ARP57768_P050) antibody is Catalog # AAP57768 (Previous Catalog # AAPP38825) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MRPL47 |
| Uniprot ID |
Q9HD33-3 |
| Protein Name |
39S ribosomal protein L47, mitochondrial |
| Protein Accession # |
NP_817125 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_177988 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MRPL47 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-MRPL47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
