PYCR1 Antibody - middle region (ARP57751_P050)

• Product Number: ARP57751_P050
• Name: PYCR1 Antibody - middle region (ARP57751_P050)
• Protein Size (# AA): 316 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 5831
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Pyrroline-5-carboxylate reductase 1
• Alias Symbols: P5C, P5CR, PRO3, PYCR, PIG45, PP222, ARCL2B, ARCL3B
• Peptide Sequence: Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377
• Description of Target: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
• Protein Interactions: FUS; SUMO2; NEDD8; MDM2; SUZ12; RNF2; BMI1; HNRNPD; BAG3; BNIPL; UBC; ITGA4; DAB2; MDC1; CUL3; NUDT21; CDK2AP2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Other Applications Image 1 Data: WB Suggested Anti-PYCR1 antibody
  Titration: 3.3 ug/ml
  Positive Control: Human fibroblast
  
• Blocking Peptide: For anti-PYCR1 (ARP57751_P050) antibody is Catalog # AAP57751 (Previous Catalog # AAPP38808)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR1
• Uniprot ID: A6NFM2
• Protein Name: Pyrroline-5-carboxylate reductase 1, mitochondrial
• Sample Type Confirmation:

  PYCR1 is supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

• Protein Accession #: NP_722546
• Purification: Affinity Purified
• Nucleotide Accession #: NM_153824
• Tested Species Reactivity: Human
• Gene Symbol: PYCR1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
• Image 1: Human 293T
  
  PYCR1 antibody - middle region (ARP57751_P050) validated by WB using 293T cells lysate at 1 ug/ml.PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T
• Image 2: Human 721_B
  
  WB Suggested Anti-PYCR1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysatePYCR1 is supported by BioGPS gene expression data to be expressed in 721_B
• Image 3: Human fibroblast
  
  Lanes:
  1. 10 ug human fibroblast lysate
  2. 10 ug PYCR1 KO human fibroblast lysate
  Primary Antibody Dilution:
  1:300
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Gene Name:
  PYCR1
  Submitted by:
  Anonymous
  
• Image 4: Human fibroblast
  
  Lanes:
  1. 10 ug human fibroblast lysate
  2. 10 ug PYCR1 KO human fibroblast lysate
  Primary Antibody Dilution:
  1:300
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Gene Name:
  PYCR1
  Submitted by:
  Anonymous