MYL6 Antibody - middle region (ARP57712_P050)

• Product Number: ARP57712_P050
• Name: MYL6 Antibody - middle region (ARP57712_P050)
• Protein Size (# AA): 151 amino acids
• Molecular Weight: 17 kDa
• NCBI Gene Id: 4637
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Myosin, light chain 6, alkali, smooth muscle and non-muscle
• Alias Symbols: LC17, ESMLC, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, MLC3SM, LC17-GI, LC17-NM
• Peptide Sequence: Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fu,Z.Y., (2006) Acta Biochim. Biophys. Sin. (Shanghai) 38 (9), 625-632
• Description of Target: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
• Protein Interactions: ADAMTS12; UBC; MDM2; SUZ12; MYL12A; MYH9; MYH14; GRIPAP1; UBD; GLP1R; PAN2; VCAM1; MLH1; ITGA4; FN1; TSGA10; ESR1; HSP90AB1; DES; ATP5B; MYL6B; LRRK2; CUL1; CDK2; ARRB1; ARRB2; SUMO2; SRRM2; USP45; USP46; USP18; MOB4; DNAJB9; NUDT21; EWSR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Additional Information: IHC Information: Prostate, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Prostate, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-MYL6 (ARP57712_P050) antibody is Catalog # AAP57712 (Previous Catalog # AAPP34206)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYL6
• Uniprot ID: P60660
• Protein Name: Myosin light polypeptide 6
• Sample Type Confirmation:

  MYL6 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_524147
• Purification: Affinity Purified
• Nucleotide Accession #: NM_079423
• Tested Species Reactivity: Human, Mouse, Rat
• Gene Symbol: MYL6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
• Image 1: Human Prostate
  
  Human Prostate
• Image 2: Human Skeletal Muscle
  
  Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-MYL6 antibody (ARP57712_P050)
• Image 3: Human HepG2
  
  WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml
  Positive Control: HepG2 cell lysateMYL6 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 4: Western Blot
  
  25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.