| Product Number |
ARP57413_P050 |
| Product Page |
www.avivasysbio.com/lyrm1-antibody-middle-region-arp57413-p050.html |
| Name |
LYRM1 Antibody - middle region (ARP57413_P050) |
| Protein Size (# AA) |
122 amino acids |
| Molecular Weight |
14kDa |
| NCBI Gene Id |
57149 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
LYR motif containing 1 |
| Alias Symbols |
A211C6.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes. |
| Protein Interactions |
MTAP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LYRM1 (ARP57413_P050) antibody |
| Blocking Peptide |
For anti-LYRM1 (ARP57413_P050) antibody is Catalog # AAP57413 (Previous Catalog # AAPP41412) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LYRM1 |
| Uniprot ID |
O43325 |
| Protein Name |
LYR motif-containing protein 1 |
| Protein Accession # |
NP_065157 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020424 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LYRM1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human Placenta
 | WB Suggested Anti-LYRM1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta |
|
|
