RAGE Antibody - N-terminal region (ARP56743_P050)

Data Sheet
 
Product Number ARP56743_P050
Product Page www.avivasysbio.com/rage-antibody-n-terminal-region-arp56743-p050.html
Name RAGE Antibody - N-terminal region (ARP56743_P050)
Protein Size (# AA) 419 amino acids
Molecular Weight 48kDa
NCBI Gene Id 5891
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MOK protein kinase
Alias Symbols RAGE, RAGE1, STK30, RAGE-1
Peptide Sequence Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Luo,H.R., (2001) Neuron 31 (3), 439-451
Description of Target RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
Protein Interactions UBC; WDR18; SDF4; HUWE1; ZNF223; MOK; INSR; MAPK6; MYC; JUN; CCNB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MOK (ARP56743_P050) antibody
Blocking Peptide For anti-MOK (ARP56743_P050) antibody is Catalog # AAP56743 (Previous Catalog # AAPP39601)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RAGE
Uniprot ID Q9UQ07
Protein Name MAPK/MAK/MRK overlapping kinase
Publications

Tafani, M. et al. Hypoxia-increased RAGE and P2X7R expression regulates tumor cell invasion through phosphorylation of Erk1/2 and Akt and nuclear translocation of NF-{kappa}B. Carcinogenesis 32, 1167-75 (2011). 21642357

Protein Accession # NP_055041
Purification Affinity Purified
Nucleotide Accession # NM_013401
Tested Species Reactivity Human
Gene Symbol MOK
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human MCF-7
WB Suggested Anti-RAGE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com