Product Number |
ARP56414_P050 |
Product Page |
www.avivasysbio.com/prep-antibody-middle-region-arp56414-p050.html |
Name |
PREP Antibody - middle region (ARP56414_P050) |
Protein Size (# AA) |
710 amino acids |
Molecular Weight |
81kDa |
NCBI Gene Id |
5550 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Prolyl endopeptidase |
Alias Symbols |
PE, PEP |
Peptide Sequence |
Synthetic peptide located within the following region: LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374 |
Description of Target |
PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d |
Protein Interactions |
SUMO1; BRCA1; TARS; UBD; SIRT7; UBC; OXT; NTS; TAC1; KNG1; AGT; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PREP (ARP56414_P050) antibody |
Blocking Peptide |
For anti-PREP (ARP56414_P050) antibody is Catalog # AAP56414 (Previous Catalog # AAPP38723) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PREP |
Uniprot ID |
P48147 |
Protein Name |
Prolyl endopeptidase |
Sample Type Confirmation |
PREP is strongly supported by BioGPS gene expression data to be expressed in HT1080 |
Protein Accession # |
NP_002717 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002726 |
Tested Species Reactivity |
Human |
Gene Symbol |
PREP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HT1080
 | WB Suggested Anti-PREP Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HT1080 cell lysatePREP is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells |
|
Image 2 | Human, purified protein
 | PREP antibody - middle region (ARP56414_P050) validated by WB using neuroblastome, purified prep at 1:1000. |
|