| Product Number |
ARP54576_P050-HRP |
| Product Page |
www.avivasysbio.com/gclc-antibody-n-terminal-region-hrp-arp54576-p050-hrp.html |
| Name |
GCLC Antibody - N-terminal region : HRP (ARP54576_P050-HRP) |
| Protein Size (# AA) |
637 amino acids |
| Molecular Weight |
73kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
2729 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glutamate-cysteine ligase, catalytic subunit |
| Alias Symbols |
GCL, GCS, GLCL, GLCLC |
| Peptide Sequence |
Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Jonsson,L.S., (2008) Int Arch Occup Environ Health 81 (7), 913-919 |
| Description of Target |
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773 kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; PPID; GCLM; CCL22; PAXIP1; ELAVL1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-GCLC (ARP54576_P050-HRP) antibody |
| Blocking Peptide |
For anti-GCLC (ARP54576_P050-HRP) antibody is Catalog # AAP54576 (Previous Catalog # AAPP31360) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GCLC |
| Uniprot ID |
P48506 |
| Protein Name |
Glutamate-cysteine ligase EMBL BAE97618.1 |
| Publications |
Tomasi, M. L. et al. Molecular mechanisms of lipopolysaccharide-mediated inhibition of glutathione synthesis in mice. Free Radic. Biol. Med. 68, 148-58 (2014). WB, Human, Dog, Pig, Rabbit, Rat, Guinea pig, Mouse, Bovine, Horse, Zebrafish 24296246 |
| Protein Accession # |
NP_001489 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001498 |
| Gene Symbol |
GCLC |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | |
