| Product Number |
ARP53503_P050 |
| Product Page |
www.avivasysbio.com/2410015m20rik-antibody-c-terminal-region-arp53503-p050.html |
| Name |
Micos13 Antibody - C-terminal region (ARP53503_P050) |
| Protein Size (# AA) |
119 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
224904 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
QI, QIL1, Mic13, sr104, 2410015M20Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: TGLEMPQLPTPPKIKFPNFRDSWNSGIISVMSALSVAPSKAREYSKEGWE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-2410015M20Rik (ARP53503_P050) antibody |
| Blocking Peptide |
Available upon request |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of 2410015M20Rik |
| Uniprot ID |
Q8R404 |
| Protein Name |
Protein QIL1 |
| Protein Accession # |
NP_694792 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153152 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
2410015M20Rik |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 79% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-2410015M20Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine |
|
|
