| Product Number |
ARP53359_P050 |
| Product Page |
www.avivasysbio.com/lrrc50-antibody-n-terminal-region-arp53359-p050.html |
| Name |
LRRC50 Antibody - N-terminal region (ARP53359_P050) |
| Protein Size (# AA) |
725 amino acids |
| Molecular Weight |
80kDa |
| NCBI Gene Id |
123872 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Dynein, axonemal, assembly factor 1 |
| Alias Symbols |
swt, DAU1, ODA7, CILD13, LRRC50 |
| Peptide Sequence |
Synthetic peptide located within the following region: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
| Description of Target |
LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DNAAF1 (ARP53359_P050) antibody |
| Blocking Peptide |
For anti-DNAAF1 (ARP53359_P050) antibody is Catalog # AAP53359 (Previous Catalog # AAPP30942) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50 |
| Uniprot ID |
Q8NEP3 |
| Protein Name |
Dynein assembly factor 1, axonemal |
| Publications |
Basten, S. G. et al. Mutations in LRRC50 predispose zebrafish and humans to seminomas. PLoS Genet. 9, e1003384 (2013). 23599692 |
| Sample Type Confirmation |
DNAAF1 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_848547 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178452 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DNAAF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-LRRC50 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateDNAAF1 is supported by BioGPS gene expression data to be expressed in 721_B |
|
