| Product Number |
ARP53140_P050 |
| Product Page |
www.avivasysbio.com/9030625a04rik-antibody-c-terminal-region-arp53140-p050.html |
| Name |
Lacc1 Antibody - C-terminal region (ARP53140_P050) |
| Protein Size (# AA) |
430 amino acids |
| Molecular Weight |
48 kDa |
| NCBI Gene Id |
210808 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RIKEN cDNA 9030625A04 gene |
| Alias Symbols |
9030625A04Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-Lacc1 (ARP53140_P050) antibody |
| Blocking Peptide |
For anti-Lacc1 (ARP53140_P050) antibody is Catalog # AAP53140 (Previous Catalog # AAPP36209) |
| Uniprot ID |
Q8BZT9 |
| Protein Name |
Purine nucleoside phosphorylase LACC1
|
| Protein Accession # |
NP_766076 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172488 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Lacc1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB, IP |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-9030625A04Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
