CDR2 Antibody - N-terminal region (ARP51161_T100)

Data Sheet
 
Product Number ARP51161_T100
Product Page www.avivasysbio.com/cdr2-antibody-n-terminal-region-arp51161-t100.html
Name CDR2 Antibody - N-terminal region (ARP51161_T100)
Protein Size (# AA) 454 amino acids
Molecular Weight 52 kDa
NCBI Gene Id 1039
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cerebellar degeneration-related protein 2, 62kDa
Alias Symbols Yo, CDR62
Peptide Sequence Synthetic peptide located within the following region: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Balbo,M., (2005) FEMS Microbiol. Lett. 249 (2), 359-366
Description of Target cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.
Protein Interactions SMARCE1; CEP57L1; KANSL1; CCDC153; C4orf46; TXLNA; ALS2CR11; C1orf216; HAUS1; ANKRD36BP1; TCHP; FAM161A; ENKD1; FAM110A; LENG1; SCNM1; SH2D4A; LIN37; RCOR3; TBC1D22B; WDYHV1; CCHCR1; AMOTL2; FZR1; RSPH14; CHIC2; MRPL28; TMCC2; HDAC4; EIF4E2; TTR; COX5B; T
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDR2 (ARP51161_T100) antibody
Additional Information IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-CDR2 (ARP51161_T100) antibody is Catalog # AAP51161 (Previous Catalog # AAPP28032)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDR2
Uniprot ID Q01850
Protein Name Cerebellar degeneration-related protein 2
Sample Type Confirmation

CDR2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001793
Purification Protein A purified
Nucleotide Accession # NM_001802
Tested Species Reactivity Human
Gene Symbol CDR2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Liver
Human Liver
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com