| Product Number |
ARP49654_P050 |
| Product Page |
www.avivasysbio.com/lass1-antibody-middle-region-arp49654-p050.html |
| Name |
LASS1 Antibody - middle region (ARP49654_P050) |
| Protein Size (# AA) |
350 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
10715 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ceramide synthase 1 |
| Description |
|
| Alias Symbols |
EPM8, GDF1, LAG1, UOG1, GDF-1, LASS1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Koybasi,S., (2004) J. Biol. Chem. 279 (43), 44311-44319 |
| Description of Target |
This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserv |
| Protein Interactions |
UBC; MAPK6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CERS1 (ARP49654_P050) antibody |
| Blocking Peptide |
For anti-CERS1 (ARP49654_P050) antibody is Catalog # AAP49654 (Previous Catalog # AAPP29237) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LASS1 |
| Uniprot ID |
P27544 |
| Protein Name |
Ceramide synthase 1 |
| Publications |
Aneuploid Cell Survival Relies upon Sphingolipid Homeostasis. Cancer Res. 77, 5272-5286 (2017). 28775166 |
| Protein Accession # |
NP_067090 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021267 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CERS1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-LASS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate |
|
| Image 2 | Human PANC1 Whole Cell
 | Host: Rabbit
Target Name: CERS1
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 2ug/ml |
|
| Image 3 | A549, U937
 | Host: Rabbit
Target: CERS1
Positive control (+): A549 (N03)
Negative control (-): U937 (N31)
Antibody concentration: 3ug/ml |
|
| Image 4 | Human SGC-7901 Whole Cell
 | Host: Rabbit
Target Name: CERS1
Sample Tissue: Human SGC-7901 Whole Cell
Antibody Dilution: 5ug/ml |
|
