NANOG Antibody - N-terminal region (ARP47988_P050)

• Product Number: ARP47988_P050
• Name: NANOG Antibody - N-terminal region (ARP47988_P050)
• Protein Size (# AA): 305 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 79923
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Nanog homeobox
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDLLIQDSPDSST
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Piestun,D., (2006) Biochem. Biophys. Res. Commun. 343 (1), 279-285
• Description of Target: NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
• Protein Interactions: DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NANOG (ARP47988_P050) antibody is Catalog # AAP47988 (Previous Catalog # AAPS20104)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG
• Uniprot ID: Q9H9S0
• Protein Name: Homeobox protein NANOG
• Protein Accession #: NP_079141
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024865
• Tested Species Reactivity: Human
• Gene Symbol: NANOG
• Predicted Species Reactivity: Human, Cow, Dog, Goat, Horse, Pig, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Goat: 100%; Horse: 92%; Human: 100%; Pig: 100%; Sheep: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate