| Product Number |
ARP47857_P050-FITC |
| Product Page |
www.avivasysbio.com/prd-antibody-middle-region-fitc-arp47857-p050-fitc.html |
| Name |
prd Antibody - middle region : FITC (ARP47857_P050-FITC) |
| Protein Size (# AA) |
613 amino acids |
| Molecular Weight |
65kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
34629 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paired |
| Alias Symbols |
CG6716, Dmel\CG6716, pr, Prd, PRD |
| Peptide Sequence |
Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments. |
| Protein Interactions |
ci; Rassf; Ras85D; Mlf; Damm; Mer; CG42676; gsb; CycE; LIMK1; dm; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-prd (ARP47857_P050-FITC) antibody |
| Blocking Peptide |
For anti-prd (ARP47857_P050-FITC) antibody is Catalog # AAP47857 (Previous Catalog # AAPP27301) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Uniprot ID |
P06601 |
| Protein Name |
Segmentation protein paired |
| Protein Accession # |
NP_723721 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_164990 |
| Gene Symbol |
prd |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Fruit fly: 100% |
| Image 1 | |
|
