| Product Number |
ARP47771_P050 |
| Product Page |
www.avivasysbio.com/foxn4-antibody-c-terminal-region-arp47771-p050.html |
| Name |
FOXN4 Antibody - C-terminal region (ARP47771_P050) |
| Protein Size (# AA) |
517 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
121643 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box N4 |
| Alias Symbols |
FLJ35967 |
| Peptide Sequence |
Synthetic peptide located within the following region: HHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINIS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Scherer,S.E., (2006) Nature 440 (7082), 346-351 |
| Description of Target |
Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism.Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism (Li et al., 2004 [PubMed 15363391]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-178 BC146825.1 2-179 179-191 AK131519.1 179-191 192-500 BC146825.1 193-501 501-1569 AF425596.1 276-1344 1570-3350 BC146825.1 1571-3351 3351-3356 AA421288.1 1-6 c |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXN4 (ARP47771_P050) antibody |
| Blocking Peptide |
For anti-FOXN4 (ARP47771_P050) antibody is Catalog # AAP47771 (Previous Catalog # AAPP28610) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXN4 |
| Uniprot ID |
Q96NZ1 |
| Protein Name |
Forkhead box protein N4 |
| Protein Accession # |
NP_998761 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_213596 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXN4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79% |
| Image 1 | Human HeLa
 | WB Suggested Anti-FOXN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate |
|
|
