| Product Number |
ARP47476_P050 |
| Product Page |
www.avivasysbio.com/fabp1-antibody-n-terminal-region-arp47476-p050.html |
| Name |
FABP1 Antibody - N-terminal region (ARP47476_P050) |
| Protein Size (# AA) |
127 amino acids |
| Molecular Weight |
14kDa |
| NCBI Gene Id |
2168 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Fatty acid binding protein 1, liver |
| Alias Symbols |
FABPL, L-FABP |
| Peptide Sequence |
Synthetic peptide located within the following region: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yamada,Y., (2008) Int. J. Mol. Med. 21 (6), 801-808 |
| Description of Target |
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid bi |
| Protein Interactions |
FLNA; SNTA1; GRB2; PPARG; PPARA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FABP1 (ARP47476_P050) antibody |
| Additional Information |
IHC Information: Colon
IHC Information: Kidney
IHC Information: Liver |
| Blocking Peptide |
For anti-FABP1 (ARP47476_P050) antibody is Catalog # AAP47476 (Previous Catalog # AAPS17601) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FABP1 |
| Uniprot ID |
P07148 |
| Protein Name |
Fatty acid-binding protein, liver |
| Protein Accession # |
NP_001434 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001443 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FABP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Small Intestine
 | WB Suggested Anti-FABP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine |
|
