Product Number |
ARP47372_P050-Biotin |
Product Page |
www.avivasysbio.com/cln6-antibody-c-terminal-region-biotin-arp47372-p050-biotin.html |
Name |
CLN6 Antibody - C-terminal region : Biotin (ARP47372_P050-Biotin) |
Protein Size (# AA) |
311 amino acids |
Molecular Weight |
36kDa |
Conjugation |
Biotin |
NCBI Gene Id |
54982 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ceroid-lipofuscinosis, neuronal 6, late infantile, variant |
Alias Symbols |
nclf, CLN4A, HsT18960 |
Peptide Sequence |
Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Heine,C., (2007) Mol. Membr. Biol. 24 (1), 74-87 |
Description of Target |
CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. |
Protein Interactions |
RNF2; BMI1; ILK; env; DERL1; VCP; UBC; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-CLN6 (ARP47372_P050-Biotin) antibody |
Blocking Peptide |
For anti-CLN6 (ARP47372_P050-Biotin) antibody is Catalog # AAP47372 (Previous Catalog # AAPP28240) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLN6 |
Uniprot ID |
Q9NWW5 |
Protein Name |
Ceroid-lipofuscinosis neuronal protein 6 |
Sample Type Confirmation |
CLN6 is supported by BioGPS gene expression data to be expressed in HEK293T |
Protein Accession # |
NP_060352 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017882 |
Gene Symbol |
CLN6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
Image 1 | |
|