BACE2 Antibody - middle region (ARP46852_P050)

Data Sheet
 
Product Number ARP46852_P050
Product Page www.avivasysbio.com/bace2-antibody-middle-region-arp46852-p050.html
Name BACE2 Antibody - middle region (ARP46852_P050)
Protein Size (# AA) 396 amino acids
Molecular Weight 37kDa
NCBI Gene Id 25825
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Beta-site APP-cleaving enzyme 2
Alias Symbols ASP1, BAE2, DRAP, AEPLC, ALP56, ASP21, CDA13, CEAP1
Peptide Sequence Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Protein Interactions UBC; BACE2; APP; GGA1; GGA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BACE2 (ARP46852_P050) antibody
Blocking Peptide For anti-BACE2 (ARP46852_P050) antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BACE2
Uniprot ID Q9Y5Z0
Protein Name Beta-secretase 2
Sample Type Confirmation

BACE2 is supported by BioGPS gene expression data to be expressed in ACHN

Protein Accession # NP_620477
Purification Affinity Purified
Nucleotide Accession # NM_138992
Tested Species Reactivity Human
Gene Symbol BACE2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 92%
Image 1
Human ACHN
WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN cell lysateBACE2 is supported by BioGPS gene expression data to be expressed in ACHN
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com