| Product Number |
ARP46780_P050 |
| Product Page |
www.avivasysbio.com/afg3l2-antibody-middle-region-arp46780-p050.html |
| Name |
AFG3L2 Antibody - middle region (ARP46780_P050) |
| Protein Size (# AA) |
797 amino acids |
| Molecular Weight |
88kDa |
| NCBI Gene Id |
10939 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
AFG3 ATPase family gene 3-like 2 (S. cerevisiae) |
| Description |
|
| Alias Symbols |
OPA12, SCA28, SPAX5 |
| Peptide Sequence |
Synthetic peptide located within the following region: VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Banfi,S., (1999) Genomics 59 (1), 51-58 |
| Description of Target |
AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. |
| Protein Interactions |
SUMO2; UBC; SUZ12; RNF2; HIPK4; FBXO6; BTK; APP; MAPK8IP2; RAC2; ICT1; BECN1; CLN3; USP50; PHC2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AFG3L2 (ARP46780_P050) antibody |
| Blocking Peptide |
For anti-AFG3L2 (ARP46780_P050) antibody is Catalog # AAP46780 (Previous Catalog # AAPP27579) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AFG3L2 |
| Uniprot ID |
Q9Y4W6 |
| Protein Name |
AFG3-like protein 2 |
| Publications |
Depletion of mitochondrial protease OMA1 alters proliferative properties and promotes metastatic growth of breast cancer cells. Sci Rep. 9, 14746 (2019). 31611601 |
| Sample Type Confirmation |
AFG3L2 is supported by BioGPS gene expression data to be expressed in HeLa |
| Protein Accession # |
NP_006787 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006796 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AFG3L2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-AFG3L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysateAFG3L2 is supported by BioGPS gene expression data to be expressed in HeLa |
|
