| Product Number |
ARP45038_T100 |
| Product Page |
www.avivasysbio.com/aadac-antibody-c-terminal-region-arp45038-t100.html |
| Name |
AADAC Antibody - C-terminal region (ARP45038_T100) |
| Protein Size (# AA) |
399 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
13 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Arylacetamide deacetylase (esterase) |
| Alias Symbols |
DAC, CES5A1 |
| Peptide Sequence |
Synthetic peptide located within the following region: NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Frick,C., (2004) J. Biol. Chem. 279 (30), 31131-31138 |
| Description of Target |
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AADAC (ARP45038_T100) antibody |
| Blocking Peptide |
For anti-AADAC (ARP45038_T100) antibody is Catalog # AAP45038 (Previous Catalog # AAPP12326) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human AADAC |
| Uniprot ID |
P22760 |
| Protein Name |
Arylacetamide deacetylase |
| Protein Accession # |
NP_001077 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001086 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AADAC |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 86% |
| Image 1 | Human Liver
 | WB Suggested Anti-AADAC Antibody Titration: 2.5ug/ml
Positive Control: Human Liver |
|
|
