DPP6 Antibody - middle region : Biotin (ARP44867_P050-Biotin)

• Product Number: ARP44867_P050-Biotin
• Name: DPP6 Antibody - middle region : Biotin (ARP44867_P050-Biotin)
• Protein Size (# AA): 801 amino acids
• Molecular Weight: 91kDa
• Conjugation: Biotin
• NCBI Gene Id: 1804
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dipeptidyl-peptidase 6
• Alias Symbols: VF2, DPL1, DPPX, MRD33
• Peptide Sequence: Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
• Description of Target: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Protein Interactions: KCND2; PRNP;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-DPP6 (ARP44867_P050-Biotin) antibody is Catalog # AAP44867 (Previous Catalog # AAPP25946)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPP6
• Uniprot ID: P42658
• Protein Name: Dipeptidyl aminopeptidase-like protein 6
• Protein Accession #: NP_001034439
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001039350
• Gene Symbol: DPP6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
• Image 1: