HSD3B2 Antibody - N-terminal region (ARP44239_P050)

• Product Number: ARP44239_P050
• Name: HSD3B2 Antibody - N-terminal region (ARP44239_P050)
• Protein Size (# AA): 372 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 3284
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
• Alias Symbols: HSDB, HSD3B, SDR11E2
• Peptide Sequence: Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shigematsu,K., (2008) Eur. J. Endocrinol. 158 (6), 867-878
• Description of Target: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
• Protein Interactions: ATP4A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HSD3B2 (ARP44239_P050) antibody is Catalog # AAP44239 (Previous Catalog # AAPP25619)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B2
• Uniprot ID: P26439
• Protein Name: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
• Protein Accession #: NP_000189
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000198
• Tested Species Reactivity: Human, Monkey
• Gene Symbol: HSD3B2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Monkey
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 93%; Goat: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 86%; Sheep: 85%
• Image 1: Human 293T
  
  WB Suggested Anti-HSD3B2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: 293T cell lysate
• Image 2: Monkey adrenal gland
  
  Sample Type:
  Monkey adrenal gland
  Primary Antibody Dilution:
  1:25
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  Brown: HSD3B2 Blue: Nucleus
  Gene Name:
  HSD3B2
  Submitted by:
  Jonathan Bertin, Endoceutics Inc.
• Image 3: Monkey vagina
  
  Sample Type:
  Monkey vagina
  Primary Antibody Dilution:
  1:25
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  Brown: HSD3B2 Blue: Nucleus
  Gene Name:
  HSD3B2
  Submitted by:
  Jonathan Bertin, Endoceutics Inc.