RNF25 Antibody - middle region (ARP43300_P050)

• Product Number: ARP43300_P050
• Name: RNF25 Antibody - middle region (ARP43300_P050)
• Protein Size (# AA): 459 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 64320
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Ring finger protein 25
• Alias Symbols: AO7
• Peptide Sequence: Synthetic peptide located within the following region: CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Asamitsu,K., (2003) J. Biol. Chem. 278 (29), 26879-26887
• Description of Target: RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.
• Protein Interactions: UBE2E3; UBE2D2; UBC; TRIM27; UBE2D1; UBE2U; UBE2D4; UBE2L6; UBE2E2; UBE2E1; UBE2D3; RELA; NKD2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-RNF25 (ARP43300_P050) antibody is Catalog # AAP43300 (Previous Catalog # AAPP11375)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF25
• Uniprot ID: Q96BH1
• Protein Name: E3 ubiquitin-protein ligase RNF25
• Sample Type Confirmation:

  RNF25 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_071898
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022453
• Tested Species Reactivity: Human
• Gene Symbol: RNF25
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-RNF25 Antibody Titration: 0.5 ug/ml
  Positive Control: HepG2 cell lysateRNF25 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 2: Human Skin
  
  Human Skin