Product Number |
ARP42423_P050-Biotin |
Product Page |
www.avivasysbio.com/cobll1-antibody-n-terminal-region-biotin-arp42423-p050-biotin.html |
Name |
COBLL1 Antibody - N-terminal region : Biotin (ARP42423_P050-Biotin) |
Protein Size (# AA) |
1166 amino acids |
Molecular Weight |
128kDa |
Conjugation |
Biotin |
NCBI Gene Id |
22837 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
COBL-like 1 |
Alias Symbols |
COBLR1 |
Peptide Sequence |
Synthetic peptide located within the following region: SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Carroll,E.A., (2003) Dev. Biol. 262 (1), 16-31 |
Description of Target |
The function remains known. |
Protein Interactions |
NRD1; PACSIN1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-COBLL1 (ARP42423_P050-Biotin) antibody |
Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 8%. |
Blocking Peptide |
For anti-COBLL1 (ARP42423_P050-Biotin) antibody is Catalog # AAP42423 (Previous Catalog # AAPP11560) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human COBLL1 |
Uniprot ID |
A6NMZ3 |
Protein Name |
Cordon-bleu protein-like 1 |
Sample Type Confirmation |
COBLL1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_055715 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014900 |
Gene Symbol |
COBLL1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | |
|