| Product Number |
ARP42365_P050 |
| Product Page |
www.avivasysbio.com/atp6v0a2-antibody-n-terminal-region-arp42365-p050.html |
| Name |
ATP6V0A2 Antibody - N-terminal region (ARP42365_P050) |
| Protein Size (# AA) |
856 amino acids |
| Molecular Weight |
98kDa |
| Subunit |
a isoform 2 |
| NCBI Gene Id |
23545 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATPase, H+ transporting, lysosomal V0 subunit a2 |
| Alias Symbols |
A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D |
| Peptide Sequence |
Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kornak,U., (2008) Nat. Genet. 40 (1), 32-34 |
| Description of Target |
The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain (Smith et al., 2003 [PubMed 14580332]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; RPL10L; PTRH2; ATP6V1D; RPS15; RPS2; SLC25A3; AKT1; ELAVL1; CYTH2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ATP6V0A2 (ARP42365_P050) antibody |
| Additional Information |
IHC Information: Human Kidney (formalin-fixed, paraffin-embedded) stained with ATP6V0A2 antibody ARP42365_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Kidney (formalin-fixed, paraffin-embedded) stained with ATP6V0A2 antibody ARP42365_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen. |
| Other Applications Image 1 Data |
IHC Suggested Anti-ATP6V0A2 antibody
Titration: 4 ug/ml
Positive Control: HeLa cells
|
| Blocking Peptide |
For anti-ATP6V0A2 (ARP42365_P050) antibody is Catalog # AAP42365 (Previous Catalog # AAPP11553) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A2 |
| Uniprot ID |
Q9Y487 |
| Protein Name |
V-type proton ATPase 116 kDa subunit a isoform 2 |
| Protein Accession # |
NP_036595 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012463 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ATP6V0A2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Yeast, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%; Yeast: 79%; Zebrafish: 77% |
| Image 1 | human kidney
 | Anti-ATP6V0A2 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
| Image 2 | Human small intestine
 | Anti-ATP6V0A2 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
|
|
| Image 3 | Human kidney
 | Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-ATP6V0A2 antibody (ARP42365_P050) |
|
| Image 4 | MCF7, HEK293
 | Host: Rabbit
Target: ATP6V0A2
Positive control (+): MCF7 (N10)
Negative control (-): HEK293 (HEK293)
Antibody concentration: 1ug/ml |
|
| Image 5 | Human HeLa
 | ATP6V0A2 antibody - N-terminal region (ARP42365_P050) validated by WB using HeLa cells at 1:300. |
|
| Image 6 | Human Hela
 | Application: Western blotting
Species+tissue/cell type: HeLa cells
How many ug'sof tissue/cell lysate run on the gel:1. 10 ug untransfected HeLa lysate2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate
Primary antibody dilution: 1:300
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000 |
|
| Image 7 | Human Hela
 | Application: IHC/Immunofluorescence
Species+tissue/cell type:A. untransfected HeLa cellsB. mATP6V0A2-FLAG transfected HeLa cellsC. mATP6V0A2 (partial) transfected HeLa cells
Primary antibody dilution: 1:250
Secondary antibody: Anti-rabbit AlexaFluor 488
Secondary antibody dilution: 1:1000 |
|
