PKLR Antibody - N-terminal region (ARP41699_T100)

• Product Number: ARP41699_T100
• Name: PKLR Antibody - N-terminal region (ARP41699_T100)
• Protein Size (# AA): 543 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 5313
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Pyruvate kinase, liver and RBC
• Alias Symbols: PK1, PKL, RPK, PKRL
• Peptide Sequence: Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pendergrass,D.C., (2006) IUBMB Life 58 (1), 31-38
• Description of Target: PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).The protein encoded by this gene is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Protein Interactions: UBC; WWOX; SUMO4; CLEC4G; PCNA; OTUD5; USPL1; USP3; MYOC; KIF23; ARHGEF6; PXN; PAK1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-PKLR (ARP41699_T100) antibody is Catalog # AAP41699 (Previous Catalog # AAPP24342)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PKLR
• Uniprot ID: P30613-2
• Protein Name: Pyruvate kinase isozymes R/L
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that PKLR is expressed in HepG2

• Protein Accession #: NP_870986
• Purification: Protein A purified
• Nucleotide Accession #: NM_181871
• Tested Species Reactivity: Human
• Gene Symbol: PKLR
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human HepG2
  
  PKLR antibody - N-terminal region (ARP41699_T100) validated by WB using HepG2 cell lysate at 1.0ug/ml.There is BioGPS gene expression data showing that PKLR is expressed in HepG2
• Image 2: Human Kidney
  
  Rabbit Anti-PKLR Antibody
  Catalog Number: ARP41699
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X