| Product Number |
ARP41186_P050-HRP |
| Product Page |
www.avivasysbio.com/cpeb2-antibody-n-terminal-region-hrp-arp41186-p050-hrp.html |
| Name |
CPEB2 Antibody - N-terminal region : HRP (ARP41186_P050-HRP) |
| Protein Size (# AA) |
589 amino acids |
| Molecular Weight |
65kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
132864 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytoplasmic polyadenylation element binding protein 2 |
| Alias Symbols |
CPEB-2, CPE-BP2, hCPEB-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Kurihara,Y., (2003) Biol. Reprod. 69 (1), 261-268 |
| Description of Target |
CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CPEB2 (ARP41186_P050-HRP) antibody |
| Blocking Peptide |
For anti-CPEB2 (ARP41186_P050-HRP) antibody is Catalog # AAP41186 (Previous Catalog # AAPP22561) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CPEB2 |
| Uniprot ID |
Q7Z5Q1-2 |
| Protein Name |
Cytoplasmic polyadenylation element-binding protein 2 |
| Protein Accession # |
NP_872291 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182485 |
| Gene Symbol |
CPEB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | |
|
