ZNF596 Antibody - C-terminal region (ARP39992_T100)

Data Sheet
 
Product Number ARP39992_T100
Product Page www.avivasysbio.com/znf596-antibody-c-terminal-region-arp39992-t100.html
Product Name ZNF596 Antibody - C-terminal region (ARP39992_T100)
Size 100 ul
Gene Symbol ZNF596
Protein Size (# AA) 498 amino acids
Molecular Weight 58kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 169270
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 596
Peptide Sequence Synthetic peptide located within the following region: CGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEK
Target Reference Wistow,G., Unpublished (2002)
Description of Target ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions STAT5A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-ZNF596 (ARP39992_T100) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF596 (ARP39992_T100) antibody is Catalog # AAP39992 (Previous Catalog # AAPP22908)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF596
Complete computational species homology data Anti-ZNF596 (ARP39992_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF596.
Swissprot Id Q8TC21
Protein Name Zinc finger protein 596
Protein Accession # NP_775810
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF596.
Nucleotide Accession # NM_173539
Replacement Item This antibody may replace item sc-134201 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Pig, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rat: 90%
Image 1
Human Jurkat
WB Suggested Anti-ZNF596 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com