DMRTC2 Antibody - N-terminal region : Biotin (ARP39744_P050-Biotin)

Data Sheet
 
Product Number ARP39744_P050-Biotin
Product Page www.avivasysbio.com/dmrtc2-antibody-n-terminal-region-biotin-arp39744-p050-biotin.html
Name DMRTC2 Antibody - N-terminal region : Biotin (ARP39744_P050-Biotin)
Protein Size (# AA) 367 amino acids
Molecular Weight 40kDa
Conjugation Biotin
NCBI Gene Id 63946
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DMRT like family C2
Peptide Sequence Synthetic peptide located within the following region: EPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Protein Interactions TXNRD1; IRF9;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-DMRTC2 (ARP39744_P050-Biotin) antibody
Blocking Peptide For anti-DMRTC2 (ARP39744_P050-Biotin) antibody is Catalog # AAP39744
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DMRTD
Uniprot ID Q8IXT2
Protein Name doublesex- and mab-3-related transcription factor C2
Protein Accession # XP_005259205
Purification Affinity purified
Gene Symbol DMRTC2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com