CCNB3 Antibody - N-terminal region : Biotin (ARP39739_T100-Biotin)

• Product Number: ARP39739_T100-Biotin
• Name: CCNB3 Antibody - N-terminal region : Biotin (ARP39739_T100-Biotin)
• Protein Size (# AA): 111 amino acids
• Molecular Weight: 12kDa
• Conjugation: Biotin
• NCBI Gene Id: 85417
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cyclin B3
• Alias Symbols: CYCB3
• Peptide Sequence: Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Nguyen,T.B., (2002) J. Biol. Chem. 277 (44), 41960-41969
• Description of Target: CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: APP; CDK2;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CCNB3 (ARP39739_T100-Biotin) antibody is Catalog # AAP39739 (Previous Catalog # AAPS03409)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCNB3
• Protein Accession #: NP_391991
• Nucleotide Accession #: NM_033671
• Gene Symbol: CCNB3
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: