A830053O21Rik Antibody - middle region (ARP37562_P050)

Data Sheet
 
Product Number ARP37562_P050
Product Page www.avivasysbio.com/a830053o21rik-antibody-middle-region-arp37562-p050.html
Name A830053O21Rik Antibody - middle region (ARP37562_P050)
Protein Size (# AA) 168 amino acids
Molecular Weight 18kDa
NCBI Gene Id 320522
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Basic helix-loop-helix family, member a9
Alias Symbols Fin, Fingerin, A830053O21Rik
Peptide Sequence Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Bhlha9 (ARP37562_P050) antibody
Blocking Peptide For anti-Bhlha9 (ARP37562_P050) antibody is Catalog # AAP37562 (Previous Catalog # AAPP09668)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse A830053O21Rik
Uniprot ID Q5RJB0
Protein Name Class A basic helix-loop-helix protein 9
Protein Accession # NP_796156
Purification Affinity Purified
Nucleotide Accession # NM_177182
Tested Species Reactivity Mouse
Gene Symbol Bhlha9
Predicted Species Reactivity Mouse
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%
Image 1
Mouse Brain
WB Suggested Anti-A830053O21Rik Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com