KCNQ2 Antibody - N-terminal region (ARP35458_P050)

• Product Number: ARP35458_P050
• Name: KCNQ2 Antibody - N-terminal region (ARP35458_P050)
• Protein Size (# AA): 393 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 3785
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Potassium voltage-gated channel, KQT-like subfamily, member 2
• Alias Symbols: EBN, BFNC, DEE7, EBN1, ENB1, HNSPC, KV7.2, KCNA11
• Peptide Sequence: Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Soldovieri,M.V., (2006) J. Biol. Chem. 281 (1), 418-428
• Description of Target: The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by this gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1). At least five transcript variants encoding five different isoforms have been found for this gene.
• Protein Interactions: ARIH2; KCNQ3; PRKCA; CALM3; CALM1; CALM2; KCNQ1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KCNQ2 (ARP35458_P050) antibody is Catalog # AAP35458 (Previous Catalog # AAPP06695)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ2
• Uniprot ID: Q53Y30
• Protein Name: Potassium voltage-gated channel, KQT-like subfamily, member 2 EMBL AAP35692.1
• Protein Accession #: NP_742107
• Purification: Affinity Purified
• Nucleotide Accession #: NM_172109
• Tested Species Reactivity: Human, Mouse, Hamster
• Gene Symbol: KCNQ2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-KCNQ2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate
• Image 2: Hamster
  
  Lanes:
  100 ug CHO cell lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Goat anti-rabbit HRP
  Secondary Antibody Dilution:
  1:25000
  Gene Name:
  KCNQ2
  Submitted by:
  Anonymous
  
• Image 3: Human brain
  
  Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-KCNQ2 antibody (ARP35458_P050)
• Image 4: Mouse Pancreas
  
  Host: Mouse
  Target Name: KCNQ2
  Sample Tissue: Mouse Pancreas
  Antibody Dilution: 1ug/ml