| Product Number |
ARP34802_P050 |
| Product Page |
www.avivasysbio.com/c1orf61-antibody-n-terminal-region-arp34802-p050.html |
| Name |
C1ORF61 Antibody - N-terminal region (ARP34802_P050) |
| Protein Size (# AA) |
156 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
10485 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
chromosome 1 open reading frame 61 |
| Description |
|
| Alias Symbols |
CROC4, C1orf61 |
| Peptide Sequence |
Synthetic peptide located within the following region: NLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Protein Interactions |
CDK5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C1ORF61 (ARP34802_P050) antibody |
| Blocking Peptide |
For anti-C1ORF61 (ARP34802_P050) antibody is Catalog # AAP34802 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CROC4 |
| Uniprot ID |
Q13536 |
| Protein Name |
protein CROC-4 |
| Publications |
Single-cell atlas of early human brain development highlights heterogeneity of human neuroepithelial cells and early radial glia. Nat Neurosci. 24, 584-594 (2021). 33723434 |
| Protein Accession # |
XP_006711182 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C1ORF61 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human ACHN Whole Cell
 | Host: Rabbit
Target Name: CROC4
Sample Type: ACHN Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
