| Product Number |
ARP33540_T100-FITC |
| Product Page |
www.avivasysbio.com/apobec3g-antibody-n-terminal-region-fitc-arp33540-t100-fitc.html |
| Name |
APOBEC3G Antibody - N-terminal region : FITC (ARP33540_T100-FITC) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
46kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
60489 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G |
| Alias Symbols |
A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Rose,K.M., et al., (2004) J. Biol. Chem. 279 (40), 41744-41749 |
| Description of Target |
Anti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. |
| Protein Interactions |
vpr; vif; UNG1; APP; UBC; CBFB; APOBEC3G; HSPA4; gag; PTN; PRKACA; UBA52; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-APOBEC3G (ARP33540_T100-FITC) antibody |
| Blocking Peptide |
For anti-APOBEC3G (ARP33540_T100-FITC) antibody is Catalog # AAP33540 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G |
| Uniprot ID |
Q9HC16 |
| Protein Name |
DNA dC->dU-editing enzyme APOBEC-3G |
| Publications |
Chen, H., Wang, L.-W., Huang, Y.-Q. & Gong, Z.-J. Interferon-alpha Induces High Expression of APOBEC3G and STAT-1 in Vitro and in Vivo. Int. J. Mol. Sci. 11, 3501-12 (2010). WB, Human, Pig 20957108 |
| Sample Type Confirmation |
APOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Daudi |
| Protein Accession # |
NP_068594 |
| Nucleotide Accession # |
NM_021822 |
| Gene Symbol |
APOBEC3G |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 79% |
| Image 1 | |
