| Product Number |
ARP32784_P050-Biotin |
| Product Page |
www.avivasysbio.com/acsl1-antibody-c-terminal-region-biotin-arp32784-p050-biotin.html |
| Name |
ACSL1 Antibody - C-terminal region : Biotin (ARP32784_P050-Biotin) |
| Protein Size (# AA) |
698 amino acids |
| Molecular Weight |
78kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
2180 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Acyl-CoA synthetase long-chain family member 1 |
| Alias Symbols |
ACS1, LACS, FACL1, FACL2, LACS1, LACS2 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Ghosh,B., et al., (1995) Mol. Cell. Biochem. 151 (1), 77-81 |
| Description of Target |
ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
SUMO2; PARK2; ATP4A; UBC; NR3C2; ECT2; UBD; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-ACSL1 (ARP32784_P050-Biotin) antibody |
| Additional Information |
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml. |
| Blocking Peptide |
For anti-ACSL1 (ARP32784_P050-Biotin) antibody is Catalog # AAP32784 (Previous Catalog # AAPP03803) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1 |
| Uniprot ID |
P33121 |
| Protein Name |
Long-chain-fatty-acid--CoA ligase 1 |
| Publications |
Golej, D. L. et al. Long-chain acyl-CoA synthetase 4 modulates prostaglandin E? release from human arterial smooth muscle cells. J. Lipid Res. 52, 782-93 (2011). WB, Human, Mouse, Rat, Dog, Bovine, Horse, Zebrafish, Guinea pig 21242590 |
| Sample Type Confirmation |
ACSL1 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_001986 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001995 |
| Gene Symbol |
ACSL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | |
