ZEB1 Antibody - N-terminal region (ARP32422_P050)

• Product Number: ARP32422_P050
• Name: ZEB1 Antibody - N-terminal region (ARP32422_P050)
• Protein Size (# AA): 1124 amino acids
• Molecular Weight: 124kDa
• NCBI Gene Id: 6935
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger E-box binding homeobox 1
• Alias Symbols: BZP, TCF8, AREB6, FECD6, NIL2A, PPCD3, ZFHEP, ZFHX1A, DELTAEF1
• Peptide Sequence: Synthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,P.A., (2008) Nat. Cell Biol. 10 (5), 593-601
• Description of Target: ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM].
• Protein Interactions: SUMO1; CDK6; GTF2A1; UBR4; SUMO2; SIRT1; SOX2; CTBP2; CTBP1; SMAD7; SMAD6; SMARCA4; SERPINH1; SMAD3; EP300; DRAP1; KAT5; SMAD2; SMAD1; CDH1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZEB1 (ARP32422_P050) antibody is Catalog # AAP32422 (Previous Catalog # AAPP03417)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZEB1
• Uniprot ID: P37275
• Protein Name: Zinc finger E-box-binding homeobox 1
• Publications:

  Lobert, S., Graichen, M. E. & Morris, K. Coordinated regulation of beta-tubulin isotypes and epithelial-to-mesenchymal transition protein ZEB1 in breast cancer cells. Biochemistry 52, 5482-90 (2013). 23869586

• Sample Type Confirmation:

  ZEB1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_110378
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030751
• Tested Species Reactivity: Human
• Gene Symbol: ZEB1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Eye
  
  Sample Type : Eye tissue
  
• Image 2: Human HeLa
  
  Sample Type : Eye tissue
  
• Image 3: Human Eye
  
  Sample Type : Eye tissue
  
• Image 4: Human Jurkat
  
  WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysateZEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
• Image 5: Human Jurkat
  
  Human Jurkat