SOX30 Antibody - middle region (ARP32227_P050)

Data Sheet
 
Product Number ARP32227_P050
Product Page www.avivasysbio.com/sox30-antibody-middle-region-arp32227-p050.html
Name SOX30 Antibody - middle region (ARP32227_P050)
Protein Size (# AA) 753 amino acids
Molecular Weight 82kDa
NCBI Gene Id 11063
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SRY (sex determining region Y)-box 30
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: PAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Osaki,E., et al., (1999) Acids Res. 27 (12), 2503-2510
Description of Target The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.
Protein Interactions C6orf165; AHCYL1; FLI1; GNAI3; FBXO38; DDX56; DCAF4; CUL5; NME1; KIFC3; GP2; PAXIP1; BRCA1; NUDT3; BAMBI; TRAF2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOX30 (ARP32227_P050) antibody
Blocking Peptide For anti-SOX30 (ARP32227_P050) antibody is Catalog # AAP32227 (Previous Catalog # AAPP03208)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SOX30
Uniprot ID O94993
Protein Name Transcription factor SOX-30
Protein Accession # NP_848511
Purification Affinity Purified
Nucleotide Accession # NM_178424
Tested Species Reactivity Human
Gene Symbol SOX30
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Image 1
Human HepG2
WB Suggested Anti-SOX30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com