HCLS1 antibody - N-terminal region (ARP31928_T100)
Data Sheet
Product Number ARP31928_T100
Product Page www.avivasysbio.com/hcls1-antibody-n-terminal-region-arp31928-t100.html
Product Name HCLS1 antibody - N-terminal region (ARP31928_T100)
Size 100 ul
Gene Symbol HCLS1
Alias Symbols HS1, CTTNL
Protein Size (# AA) 486 amino acids
Molecular Weight 54kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 3059
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Hematopoietic cell-specific Lyn substrate 1
Description This is a rabbit polyclonal antibody against HCLS1. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Target Reference Ruzzene,M., et al., (2002) Biochem. J. 364 (Pt 1), 41-47
Description of Target HCLS1 Tyr phosphorylation catalyzed by Syk and Lyn plays a crucial role in the translocation of the protein to the membrane and is involved in the cytoskeleton rearrangement triggered by thrombin in human platelets. This gene is a substrate for caspase cleavage during apoptosis.
Protein Interactions SH2D4A; UBC; Mbp; Dlg4; NOTCH1; QKI; TERF1; TRIM29; SSBP3; BLZF1; IKBKG; LZTR1; ZBTB25; HS1BP3; HAX1; ACTR2; MAP4K1; CASP3; SYK; WAS; LYN; FGR; CSNK2A1; CD79A; ACTA1; GRB2; ACTR3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HCLS1 (ARP31928_T100) antibody is Catalog # AAP31928
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
Complete computational species homology data Anti-HCLS1 (ARP31928_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HCLS1.
Swissprot Id P14317
Protein Name Hematopoietic lineage cell-specific protein
Sample Type Confirmation

HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_005326
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HCLS1.
Nucleotide Accession # NM_005335
Replacement Item This antibody may replace item sc-1536 from Santa Cruz Biotechnology.
Conjugation Options

ARP31928_T100-FITC Conjugated

ARP31928_T100-HRP Conjugated

ARP31928_T100-Biotin Conjugated

CB Replacement sc-1536
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human kidney
Rabbit Anti-HCLS1 Antibody
Catalog Number: ARP31928
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Stomach
Rabbit Anti-HCLS1 Antibody
Catalog Number: ARP31928
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Heart
Rabbit Anti-HCLS1 Antibody
Catalog Number: ARP31928
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 4
Human Jurkat
WB Suggested Anti-HCLS1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 5
Human Jurkat
WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: JurkatHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 6
Mouse Heart
Host: Mouse
Target Name: HCLS1
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com