HCLS1 Antibody - N-terminal region (ARP31928_T100)

Data Sheet
 
Product Number ARP31928_T100
Product Page www.avivasysbio.com/hcls1-antibody-n-terminal-region-arp31928-t100.html
Name HCLS1 Antibody - N-terminal region (ARP31928_T100)
Protein Size (# AA) 486 amino acids
Molecular Weight 54kDa
NCBI Gene Id 3059
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Hematopoietic cell-specific Lyn substrate 1
Alias Symbols HS1, p75, CTTNL, lckBP1
Peptide Sequence Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ruzzene,M., et al., (2002) Biochem. J. 364 (Pt 1), 41-47
Description of Target HCLS1 Tyr phosphorylation catalyzed by Syk and Lyn plays a crucial role in the translocation of the protein to the membrane and is involved in the cytoskeleton rearrangement triggered by thrombin in human platelets. This gene is a substrate for caspase cleavage during apoptosis.
Protein Interactions SH2D4A; UBC; Mbp; Dlg4; NOTCH1; QKI; TERF1; TRIM29; SSBP3; BLZF1; IKBKG; LZTR1; ZBTB25; HS1BP3; HAX1; ACTR2; MAP4K1; CASP3; SYK; WAS; LYN; FGR; CSNK2A1; CD79A; ACTA1; GRB2; ACTR3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HCLS1 (ARP31928_T100) antibody
Blocking Peptide For anti-HCLS1 (ARP31928_T100) antibody is Catalog # AAP31928
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
Uniprot ID P14317
Protein Name Hematopoietic lineage cell-specific protein
Sample Type Confirmation

HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_005326
Purification Protein A purified
Nucleotide Accession # NM_005335
Tested Species Reactivity Human, Mouse
Gene Symbol HCLS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human Stomach
Rabbit Anti-HCLS1 Antibody
Catalog Number: ARP31928
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Heart
Rabbit Anti-HCLS1 Antibody
Catalog Number: ARP31928
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Mouse Heart
Host: Mouse
Target Name: HCLS1
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml
Image 4
Human Jurkat
WB Suggested Anti-HCLS1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 5
Human Jurkat
WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: JurkatHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 6
Human kidney
Rabbit Anti-HCLS1 Antibody
Catalog Number: ARP31928
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com