| Product Number |
ARP30991_P050-Biotin |
| Product Page |
www.avivasysbio.com/dmrt1-antibody-middle-region-biotin-arp30991-p050-biotin.html |
| Name |
DMRT1 Antibody - middle region : Biotin (ARP30991_P050-Biotin) |
| Protein Size (# AA) |
215 amino acids |
| Molecular Weight |
23kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
1761 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
doublesex and mab-3 related transcription factor 1 |
| Alias Symbols |
DMT1, CT154 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-DMRT1 (ARP30991_P050-Biotin) antibody |
| Blocking Peptide |
For anti-DMRT1 (ARP30991_P050-Biotin) antibody is Catalog # AAP30991 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DMRT1 |
| Uniprot ID |
Q9Y5R6 |
| Protein Name |
doublesex- and mab-3-related transcription factor 1 |
| Protein Accession # |
NP_068770.2 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021951.2 |
| Gene Symbol |
DMRT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 92%; Rat: 92% |
| Image 1 | |
|
