Product Number |
ARP30979_P050-Biotin |
Product Page |
www.avivasysbio.com/arnt-antibody-c-terminal-region-biotin-arp30979-p050-biotin.html |
Name |
Arnt Antibody - C-terminal region : Biotin (ARP30979_P050-Biotin) |
Protein Size (# AA) |
800 amino acids |
Molecular Weight |
88kDa |
Conjugation |
Biotin |
NCBI Gene Id |
25242 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Aryl hydrocarbon receptor nuclear translocator |
Alias Symbols |
Arnt1 |
Peptide Sequence |
Synthetic peptide located within the following region: SNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
Arnt is required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia. |
Protein Interactions |
Ahr; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-Arnt (ARP30979_P050-Biotin) antibody |
Blocking Peptide |
For anti-Arnt (ARP30979_P050-Biotin) antibody is Catalog # AAP30979 (Previous Catalog # AAPS08305) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
P41739 |
Protein Name |
Aryl hydrocarbon receptor nuclear translocator |
Protein Accession # |
NP_036912 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012780 |
Gene Symbol |
Arnt |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100% |
Image 1 | |
|