| Product Number |
P100851_T100 |
| Product Page |
www.avivasysbio.com/lhx1-antibody-c-terminal-region-p100851-t100.html |
| Name |
LHX1 Antibody - C-terminal region (P100851_T100) |
| Protein Size (# AA) |
406 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
3975 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
LIM homeobox 1 |
| Description |
|
| Alias Symbols |
LIM1, LIM-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Phillips,J.C. et al., (2002) Cytogenet. Genome Res. 97:140D-O |
| Description of Target |
LHX1 is a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. It may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. |
| Protein Interactions |
ISL1; RLIM; LHX3; OTX2; FOXA2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LHX1 (P100851_T100) antibody |
| Blocking Peptide |
For anti-LHX1 (P100851_T100) antibody is Catalog # AAP31210 (Previous Catalog # AAPP01954) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LHX1 |
| Uniprot ID |
P48742 |
| Protein Name |
LIM/homeobox protein Lhx1 |
| Protein Accession # |
NP_005559 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005568 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LHX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-LHX1 Antibody Titration: 0.4ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Liver
 | Human Liver |
|
|
