TAL1 Antibody - C-terminal region (P100630_P050)

Data Sheet
 
Product Number P100630_P050
Product Page www.avivasysbio.com/tal1-antibody-c-terminal-region-p100630-p050.html
Name TAL1 Antibody - C-terminal region (P100630_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6886
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-cell acute lymphocytic leukemia 1
Description
Alias Symbols SCL, TCL5, tal-1, bHLHa17
Peptide Sequence Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ravet, E., et al., (2004) Blood 103 (9), 3326-3335
Description of Target TAL1 is a basic helix-loop-helix transcription factor with a critical role in the development of both blood and endothelium.
Protein Interactions ELSPBP1; SIN3A; KAT2B; EP300; HOXB9; DRG1; CHD3; ZHX1; STUB1; UBC; RB1; SSBP2; SSBP3; RCOR1; KDM1A; LDB1; TCF12; TCF3; RBBP7; LYL1; HDAC2; HDAC1; CHD4; CBFA2T3; RUNX1; SUPT16H; TAL1; CDK9; TRIM33; SUV39H1; SATB1; TRIM27; NCAPG2; MAPK3; SP1; LMO1; LMO2; GA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAL1 (P100630_P050) antibody
Additional Information IHC Information: Human Breast (formalin-fixed, paraffin-embedded) stained with TAL1 antibody P100630_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Breast (formalin-fixed, paraffin-embedded) stained with TAL1 antibody P100630_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Blocking Peptide For anti-TAL1 (P100630_P050) antibody is Catalog # AAPP02080
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TAL1
Uniprot ID P17542
Protein Name T-cell acute lymphocytic leukemia protein 1
Protein Accession # NP_003180
Purification Affinity Purified
Nucleotide Accession # NM_003189
Tested Species Reactivity Human
Gene Symbol TAL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Image 1
Human Fetal Muscle
WB Suggested Anti-TAL1 Antibody Titration: 0.6ug/ml
Positive Control: Fetal Muscle cell lysate
Image 2
Human Breast
Human Breast
Image 3
Human Breast
Human Breast
Image 4
Human Liver
Human Liver
Image 5
Human Liver
Rabbit Anti-TAL1 Antibody
Catalog Number: P100630
Paraffin Embedded Tissue: Human hepatocyte cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com