| Product Number |
AVARP13033_P050 |
| Product Page |
www.avivasysbio.com/gabrg2-antibody-n-terminal-region-avarp13033-p050.html |
| Name |
GABRG2 Antibody - N-terminal region (AVARP13033_P050) |
| Protein Size (# AA) |
467 amino acids |
| Molecular Weight |
50kDa |
| Subunit |
gamma-2 |
| NCBI Gene Id |
2566 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, gamma 2 |
| Alias Symbols |
CAE2, ECA2, FEB8, DEE74, EIEE74, GEFSP3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Selmer,K.K., (2008) Acta Neurol. Scand. 117 (4), 289-292 |
| Description of Target |
GABRG2 is a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene.This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene. |
| Protein Interactions |
ZDHHC3; GABARAP; PRKCB; PRKCA; GABRG2; DRD5; PPP3CA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GABRG2 (AVARP13033_P050) antibody |
| Blocking Peptide |
For anti-GABRG2 (AVARP13033_P050) antibody is Catalog # AAP30693 (Previous Catalog # AAPP01350) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRG2 |
| Uniprot ID |
Q5REA1 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit gamma-2 |
| Protein Accession # |
NP_000807 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000816 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GABRG2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-GABRG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
|
