CXCL1 Antibody - middle region (AVARP07032_P050)

• Product Number: AVARP07032_P050
• Name: CXCL1 Antibody - middle region (AVARP07032_P050)
• Protein Size (# AA): 107 amino acids
• Molecular Weight: 8kDa
• NCBI Gene Id: 2919
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
• Alias Symbols: FSP, GRO1, GROa, MGSA, NAP-3, SCYB1, MGSA-a
• Peptide Sequence: Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Omari,K.M., et al., (2006) Glia 53 (1), 24-31
• Description of Target: Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: HIPK2; CXCL1; CXCR1; CXCR2; MMP9; ACKR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CXCL1 (AVARP07032_P050) antibody is Catalog # AAP30816 (Previous Catalog # AAPY04303)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXCL1
• Uniprot ID: P09341
• Protein Name: Growth-regulated alpha protein
• Protein Accession #: NP_001502
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001511
• Tested Species Reactivity: Human
• Gene Symbol: CXCL1
• Predicted Species Reactivity: Human, Cow, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 90%; Human: 100%; Pig: 85%; Rabbit: 90%
• Image 1: Human Small Intestine
  
  WB Suggested Anti-CXCL1 Antibody Titration: 0.0758ug/ml
  Positive Control: Human Small Intestine