| Product Number |
ARP60713_P050 |
| Product Page |
www.avivasysbio.com/pnma6a-antibody-n-terminal-region-arp60713-p050.html |
| Name |
PNMA6A Antibody - N-terminal region (ARP60713_P050) |
| Protein Size (# AA) |
399 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
84968 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paraneoplastic Ma antigen family member 6A |
| Alias Symbols |
MA6, PNMA6, PNMA6C |
| Peptide Sequence |
Synthetic peptide located within the following region: FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
PNMA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PNMA6A (ARP60713_P050) antibody |
| Blocking Peptide |
For anti-PNMA6A (ARP60713_P050) antibody is Catalog # AAP60713 (Previous Catalog # AAPP46856) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA6A |
| Uniprot ID |
P0C5W0 |
| Protein Name |
Paraneoplastic antigen-like protein 6B |
| Protein Accession # |
NP_116271 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032882 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PNMA6A |
| Predicted Species Reactivity |
Human, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Human: 100% |
| Image 1 | Human Lung
 | WB Suggested Anti-PNMA6A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung |
|
|
