| Product Number |
ARP60595_P050 |
| Product Page |
www.avivasysbio.com/wdr87-antibody-c-terminal-region-arp60595-p050.html |
| Name |
WDR87 Antibody - C-terminal region (ARP60595_P050) |
| Protein Size (# AA) |
1350 amino acids |
| Molecular Weight |
150kDa |
| NCBI Gene Id |
83889 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain 87 |
| Alias Symbols |
NYD-SP11 |
| Peptide Sequence |
Synthetic peptide located within the following region: PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR87 (ARP60595_P050) antibody |
| Blocking Peptide |
For anti-WDR87 (ARP60595_P050) antibody is Catalog # AAP60595 (Previous Catalog # AAPP46634) |
| Uniprot ID |
Q6ZQQ6 |
| Protein Name |
WD repeat-containing protein 87 |
| Protein Accession # |
BAC87627 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_031951 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WDR87 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human A549
 | WB Suggested Anti-WDR87 Antibody
Titration: 1.0 ug/ml
Positive Control: A549 Whole Cell |
|
|
