| Product Number |
ARP58962_P050 |
| Product Page |
www.avivasysbio.com/tm9sf1-antibody-c-terminal-region-arp58962-p050.html |
| Name |
TM9SF1 Antibody - C-terminal region (ARP58962_P050) |
| Protein Size (# AA) |
489 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
10548 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transmembrane 9 superfamily member 1 |
| Alias Symbols |
MP70, HMP70 |
| Peptide Sequence |
Synthetic peptide located within the following region: LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
TM9SF1 may function as channel, small molecule transporter or receptor. |
| Protein Interactions |
RNASEH1; TCOF1; P2RX7; ATP6V1B1; UBC; MME; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TM9SF1 (ARP58962_P050) antibody |
| Blocking Peptide |
For anti-TM9SF1 (ARP58962_P050) antibody is Catalog # AAP58962 (Previous Catalog # AAPP45741) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TM9SF1 |
| Uniprot ID |
Q86SZ6 |
| Protein Name |
Transmembrane 9 superfamily member 1 |
| Sample Type Confirmation |
TM9SF1 is supported by BioGPS gene expression data to be expressed in COLO205 |
| Protein Accession # |
NP_001014842 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001014842 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TM9SF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human COLO205
 | WB Suggested Anti-TM9SF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysateTM9SF1 is supported by BioGPS gene expression data to be expressed in COLO205 |
|
|
