Thap11 Antibody - C-terminal region (ARP58803_P050)

• Product Number: ARP58803_P050
• Name: Thap11 Antibody - C-terminal region (ARP58803_P050)
• Protein Size (# AA): 305 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 59016
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: THAP domain containing 11
• Alias Symbols: Ronin, AB041579, CTG-B43a, CTG-B45d, 2810036E22Rik
• Peptide Sequence: Synthetic peptide located within the following region: AAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Thap11 is a rranscriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. It is also a sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Thap11 (ARP58803_P050) antibody is Catalog # AAP58803 (Previous Catalog # AAPP38621)
• Uniprot ID: Q9JJD0
• Protein Name: THAP domain-containing protein 11
• Protein Accession #: NP_067488
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021513
• Tested Species Reactivity: Mouse
• Gene Symbol: Thap11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse Pancreas
  
  WB Suggested Anti-Thap11 Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Pancreas