| Product Number |
ARP57728_P050 |
| Product Page |
www.avivasysbio.com/mapk10-antibody-n-terminal-region-arp57728-p050.html |
| Name |
Mapk10 Antibody - N-terminal region (ARP57728_P050) |
| Protein Size (# AA) |
426 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
25272 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mitogen activated protein kinase 10 |
| Alias Symbols |
Jnk3, SAPb, SAPKC, Serk2 |
| Peptide Sequence |
Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Mapk10 is a stress-activated protein kinase. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Mapk10 (ARP57728_P050) antibody |
| Blocking Peptide |
For anti-Mapk10 (ARP57728_P050) antibody is Catalog # AAP57728 (Previous Catalog # AAPP44080) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
B0VXR6 |
| Protein Name |
JNK3 protein EMBL ABD24063.1 |
| Protein Accession # |
NP_036938 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012806 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Mapk10 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Mapk10 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Liver |
| | Image 2 | tobacco hornworm
 | Lanes:
Lane1: 40 ug tobacco hornworm larvae intestine lysate
Lane2: 100 ug tobacco hornworm larvae intestine lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Goat anti-rabbit HRP
Secondary Antibody Dilution:
1:10000
Gene Name:
Mapk10(JUNK)
Submitted by:
Dra. Helena Porta Ducoing and Biol. Gladys Jimenez Nopala
|
|
|
